PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G338300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 464aa    MW: 51966.8 Da    PI: 8.3658
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G338300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.35.3e-253988251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        rie  + rqvtfskRr g+lKKA+EL vLCdaev +++fs++g+lyey+s
  Brast04G338300.1.p 39 RIECATSRQVTFSKRRSGLLKKAYELGVLCDAEVGLLVFSPRGRLYEYAS 88
                        89999*******************************************86 PP

2K-box75.61.3e-25110203699
               K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                          ksle+a  + ++ e++ L+++i+ ++  qR+l+Ge+Les+s  eLq+LeqqLeksl+ iR+kK++ +l+qi el++k+++l  en +Lr+
  Brast04G338300.1.p 110 EKSLESAGVQMCRSEATALQQKIDAIEGYQRKLMGEGLESCSTHELQELEQQLEKSLSCIRQKKQKKMLDQILELREKKEKLLMENSSLRE 200
                         456889999********************************************************************************** PP

               K-box  97 kle 99 
                         k++
  Brast04G338300.1.p 201 KYQ 203
                         987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.4693090IPR002100Transcription factor, MADS-box
SMARTSM004327.2E-333089IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-2732104IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-263252IPR002100Transcription factor, MADS-box
PfamPF003191.6E-233986IPR002100Transcription factor, MADS-box
CDDcd002651.71E-3140105No hitNo description
PRINTSPR004042.9E-265267IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-266788IPR002100Transcription factor, MADS-box
PfamPF014861.5E-23118202IPR002487Transcription factor, K-box
PROSITE profilePS5129714.217118208IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MAEAEERIAP AAAADVEMSA SAAEKKEKGG RRGRREMRRI ECATSRQVTF SKRRSGLLKK  60
AYELGVLCDA EVGLLVFSPR GRLYEYASTT DLQKTIDRYV NHTKGAPANE KSLESAGVQM  120
CRSEATALQQ KIDAIEGYQR KLMGEGLESC STHELQELEQ QLEKSLSCIR QKKQKKMLDQ  180
ILELREKKEK LLMENSSLRE KYQALPLLEL ATRTVEAAHA RSPGTTGGEE EEPDDDNERR  240
RRQKAVEDVE TELAGKVLKK GKKKQAKDEL DRQKQAEKKR RRLEKALANS AAIISELEKK  300
KQKKKEEQQR LDEEGASIAE AVALHVLIGE DSDESRHLML NKHRRCNDWE PSAGFDFTVD  360
MQGTDIYSPG GLVCANHAYA PKGRWIDWGN AQPLPTWGEV RDLKASYYQG TFHQAVPCPG  420
FMAAQAVSSL QIGEDSSEMT SPSKGVVNRM LGSGNRLNLY REI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D4e-1432102271Myocyte-specific enhancer factor 2A
3mu6_C4e-1432102271Myocyte-specific enhancer factor 2A
3mu6_B4e-1432102271Myocyte-specific enhancer factor 2A
3mu6_A4e-1432102271Myocyte-specific enhancer factor 2A
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261281KKKQAKDELDRQKQAEKKRRR
2278282KRRRL
3279302RRRLEKALANSAAIISELEKKKQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693160.0KF469316.1 Brachypodium distachyon MADS-box transcription factor 21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3PTI70.0A0A0Q3PTI7_BRADI; Uncharacterized protein
STRINGSi019985m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38051616
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-41AGAMOUS-like 20